ITS Pidato 13069 Pidato Pengukuhan Mukhtasor

ITS
Ga,8.t6&ITSM u ~nstitutTeknologie-ISepuluh-Nopember-

2010

Ekonomi dan Teknologi

Pencemaran Laut

Oleh:
Mukhtasor

Pidato PengukuhanuntukJabatan Guru Besar
dalam Bidang Ilmu Pencemaran Laut
Jurusan Teknik Kelautan
Fakultas Teknologi Kelautan
InstitutTeknologi Sepuluh NopemberSurabaya,12Oktober 2010

Kementerian Pendidikan Nasional
InstitutTeknologi Sepuluh NopemberSurabayaIBismillaahirrahmaanirrahiim,
Assalamu’alaikum warahmatullaahiwabarakaatuh,

Yangterhormat:
BapakRektorITS selaku KetuaSenatITS,
ParaAnggota SenatITS, Ketua danAnggotaDewanPenyantunITS,
ParaUndangan dari Pejabat Sipil,MiliterdanPoln,
ParaUndangandar!PimpinanPerguruan Tinggi,
ParaPimpinandanKeluargaBesarITS,dan
Paraundangan, keluarga, sahabat,temansejawatdansegenap
civitas akadernikaITS,

AlhamdulillaahirabbiJ’a/amiin, washsha/aatu wassa/aamu
‘alanabiyina Muhammadinwa’a/aalihiwa-ashshabihi ajma’iin.
Pertama-tama,marilah kitamemanjatkan pujisyukur kehadirat
A”ahSWT,atassegalakarunia-Nya, sehinggakitadapat hadir
disini,padaRapatTerbuka SenatInstitutTeknologiSepuluh
Nopember (ITS) dalam rangka PengukuhankamisebagaiGuru
Besar,dalam keadaansehatwal’afiat.Mudah-mudahan
kesempataninimenjadimomentum bagidirikami,untuk
meningkatkannilaipengabdiankepadaAllahSWTdanuntuk
meningkatkankualitas pelayanandibidangpendidikan,penelitian
danpengabdianpadamasyarakat(PPM).KehadiranIbu/Bapak/Saudara sekalian merupakan kehormatandankebahagiaanbagi
kami;untukitukamimenyampaikan penghargaandan
terimakasih,semoga Allah SWTmencatatnya sebagaiamal
kebajikan.

Hadirin sekalianyangberbahagia,

Padakesempatan1m,perkenankanlahsaya
menyampaikanmakalahdenganjudul:

1I

Ekonomi danTeknologiPencemaranLaut

Pendahuluan
Indonesia adalah negerinusantara,negeri kepulauanterbesardidunia, memiliki kekayaan lautyangberlimpah1.FitrahIndonesiayangdemikianitumenjadikan dunia kelautan sangatmewamai sejarah perkembanganbangsaIndonesia2;danekonomi kelautan3merupakan komponenyangsangatpentingbagi pembangunan nasional. Peranan ekonomi kelautan tampakjelasdarifaktabahwakota-kotabesardiIndonesia umumnyaberkembang di wilayah pesisir. BandaAceh,Medan,Jakarta,Semarang, Surabaya, Makasar, Manadodan Ambonadalahbeberapacontohkotapesisiryangekonominyasangat didukungolehekonomi kelautan.Pembangunan ekonomi kelautan Indonesia menghadapitiga persoalan penting,yaitu(1)tekanan sosial ekonomi,(2)persoalan kelembagaan,dan(3)kerusakan lingkungan4. Salahsatu bentuk kerusakanlingkunganadalah pencemaran laut, yaitukondisi masuknyaataudimasukkannya polutanyangberupa zat,organisme atau energikedalam lingkungan laut,yang

ILuas laut Indonesiaduakali luas daratan, jumlah pulaunya17.480dan garis pantainya terpanjang ke-4 di dunia. Jenis flora dan faunapaling beragam di dunia (Dewan Kelautan Indonesia, tanpa tahun).
2Tercatat, Majapahit pada abad ke-14 telah mencapai puncak kejayaanbahari dengan menguasai Nusantaraj dan pengaruhnya mcncapaiwilayah yang kini dikenal Kamboja, India, Fi!ipina dan China.3Ekonomi kelautan meliputi ekonomi pelayaran barang danindustri maritim dan perkapalan, pcrikanan laut, pariwisata bahari,pertambangan laut Gugaminyaklgas), bangunan dan jasa kelautan.
4Persoalan sosial ckonomi misalnya kemiskinan dan rendahnya kualitaspcndidikan. Persoalan kclcmbagaan misalnya tumpang tindihperaturan. Kcrusakan lingkungan misalnya abrasi, sedimentasi,kerusakanbakaultcrumbukarang, dan pencemaran laut (DKP 2001).2?
menyebabkan turunnya kualitasairlautdanmenyebabkanairlauttersebuttidakdapatberfungsi sesuai alokasipemanfaatannya5.Bebanpencemaran laut nyata-nyata terjadi,baik di Indonesiamaupun didunia internasional6.Kecenderungannya, persoalansemakin mengancammasadepan, karenadiperkirakanlebihdansetengah populasi dunia bertempat tinggal dalamjarak100kmdarilaut.Bebanpencemaranmenyebabkan turunnya dayadukunglingkungan7.Pencemaran laut skala besar berdampak jangkapanjang; waktu penanganannya mencapaibeberapadekade.Misalnya, pencemarandiMinamata,Jepang, pertamakaliditemukan tahun1959,namunpendataan dan registrasikorbannyaterusberlangsung hingga1997.Kerugian ekonomitimbul disebabkanolehterganggunya produksi komoditas/barangdanjasa,danoleh biayapenanggulangan pencemaran itu sendiri,yangmeliputibiaya pengerukansungaidandasarlaut,kompensasi kesehatanbagikorban,dankompensasi baginelayanakibatlarangan melaut.Iniberartibahwa persoalan pencemaranlautberjalin-kelindansangateratdengan persoalan sosial ekonomimasyarakat.Oleh karenaitu,salahsatufokuspengembanganilmupengetahuandanteknologi (IPTEK) adalah perbaikan sistemkemampuan untuk mencegah atau mengurangikerugian

SDiskusitentangdcfinisi pencemaran laut, baik secara akademik, legalataupunpopuleradadiliteratur,misalnya dalam Mukhtasor (2007).
6Contoh pencemaran laut skala besar adalah tumpahan minyak diTeluk Meksiko (Amerika, April 2010), dan tumpahan minyak Montara(Australia 2009), yang terbawa arus masukkeLautTimor,Indonesia.Sejak 2006, pencemaranlumpurpanaskepertambakandanlautSidoarjo, yang merusak produktifitas perikanan andalan Jawa Timur.
7Daya dukung lingkungan adalah kemampuan lingkunganuntukmenopang kehidupan masyarakat; lingkungan laut dapat mendukungperikanan dan pariwisata, dimana secara ekologi danekonomisejumlah masyarakat saling tergantung dengan lingkungan tersebut.3pencemaran. Akumulasi pengetahuandanpengalaman telahmemperkuat kapasitas pengelolaanpencemaran laut.IPTEKpencemaran laut berkembang cukupmaju8.Peraturanlingkunganpadatingkat nasionaldaninternasionaljuga berkembang9.Banyak dari perkembangantersebutadalah sumbangan nyata dariIPTEK pencemaran laut.Demikianlah, ekonomi danteknologiadalah duafaktorpenting. Ekonomi adalahpullfactor(faktorpenarik)yangmemungkinkanmasyarakatdanpasaryanglebih luasmenerapkan IPTEK pecemaran laut; sedangkan teknologi adalahpush factor(faktorpendorong)untukberkembangnya kapasitaspengelolaan penceraman laut. Makalah orasi pengukuhan gurubesarinimenekankanpadaduafaktorpentingtersebut.Namunsebelumitu,terlebihdulu kita akan melakukan kilasbaliksecarasingkat tentang pencemaran lingkungandan pencemaranlaut.

Hadirin sekalianyangberbahagia,
Kilas Balik PencemaranLingkungan&Pencemaran Laut
Persoalanlingkungan,dankhususnya persoalanpencemaran, bukanlah fenomena baru. Faktanya, pencemarantelah menjadipermasalahan semenjakmasa awalperadabanmanusia;dankapasitaspengelolaannyaberkembang sesuaidengan tantangandankemajuan kehidupan masyarakat.

8HasH-basil penelitian dan pengembangan di bidang pencemaran lauttelah dikodifikasi dalam berbagai jurnal, proceedings, monogram danbuku teks. Kajian-kajianstateqfthe artdi bidang telah banyak, misalnyaAhmadun dkk. (2009), Mukhtasor dkk. (2000), Ofiara and Seneca(2006), ReedetaI.(1999), RobertsetaI.(2010), danTurner(2010).
9Amandemen peraturan perundangan terjadi di berbagai negara dalambeberapa beberapa dekade terakhir (misalnya GodfreeetaI.1990).Contohphaturanten ang pengelolaan pencemaran laut di Indonesiaadalah KepmenLHNo.5112004tentangBakuMutu Air Laut.4Sejarah mencatat,padaabadke-7, Khalifah UmarbinKhattabR.A.(581-644) menggulirkan programresettlement(penempatan kembali)masyarakatBaduPo.Tekanankependudukanmemberikansinyalbahwasumberdayaalam diMadinahsangatterbatas,urbanisasikianmeningkat, binatangternak semakinbanyak, danmeningkatnya persoalanpencemaran.Pada masaberikutnya,ilmuwan kekhalifahanpadaabadpertengahan11pertamakalimenemukan bahwa pencemaranlingkungandapatmenyebabkanepidemi,dan bahwa penyakitdapat menyebarluasmelalui sentuhan(dermalcontact)ataumedium udara(inhalation)12.Padaabad pertengahan,padawaktupenyakitkoleradantyphoid fever/typhusmerajaleladipenjuru Eropa13,epidemisegeradihubungkandengan kondisilingkunganyangsangattercemar. Lingkungan tanpasanitasimemadai, banyak sampah,kotoran manusiadan kotoran hewan,yangmerupakan lingkunganhidup berbagaijenisbakteripathogen14.Kesadaran ataspersoalaninimenjadi titikawalusaha pengendalian limbahdansampah.Pada abad ke-14,masyarakatMajapahit,ditanahair,telah mempunyai kesadaranyangtinggi terhadap sanitasi(kesehatan lingkungan)danpengendalianair15Padapertengahan1850-an,.diChicago dibangunsistempengolahansewage

10BerdasarkanFikih EkonomilimarbinAI-Khathab(AI-Haritsi 2006).llUraian lebih detil dapat dibaca pada AI-Faruqi and AI-Faruqi (1986).
12Ini adalah dasar pengembangan model hubungan antara dosispencemaran dengan resiko kesehatan, elemen penting pada disiplinhuman andecoIo8.YcaIriskassessmentdan penerapannya di laut (Covelloand Merkhofer 1993, MukhtasoretaI.-2002a, MukhtasoretaI.2004).13Markham, 1994
14Bakteri pathogen adalah bakteri yang menyebabkan penyakit.15p’-1.b…araaIReo09menemuanSisaangunan Jarmgan aIr: gorong-gorong,saluran irigasi, dan selokandansusunan batu bata(http://art-java. page.tlSejarah -Kerajaan-Majapahlt.htm,diakses 55pertamadiAmerikaSerikat(AS)yangkemudiandiikutioleh kotakota besar lainnya16.Padaakhirabadke-19,kota-kotaindustridiEropadan ASmenghadapijenisbarupencemaranyangberasal dari limbahindustri17.Pembuangan limbahindustrikeperairan menjadiperhatian publik.Peristiwa kontroversilainnya adalahpembuanganlimbahradioaktifkeLaut IrishdanLautMediterania.Responpublikterhadap peristiwa-peristiwainicukupbesar;danselanjutnyamengantarkanterbentuknyaundang-undang untukpengendalian pencemaran18.DieraIndonesia modem,peran pembangunanlingkunganhidup mulaieksplisitpada PelitaII,pada era OrdeBaru.Dewasaini penanganan pencemaran laut menjadi semakin penting denganterbentuknyaUU32/2009tentang PerlindungandanPengelolaanLingkungan Hidup,PP19/1999tentang PengendalianPencemaran dan/atauKerusakan Laut,Perpres05/2006tentangTim Nasional Penanggulangan Kondisi Darurat Tumpahan MinyakdiLaut,danKepmenLH51/2004tentangBaku MutuAirLaut.Ditingkatglobal, perhatianterhadappencemaranlautsemakinmeningkatketika diadakan konferensiPBB”Lawofthe Sea”padatahun 1950-an. Dengan demikian,kinihukumintemasionaltelahmemungkinkan kerjasama untuk memecahkan persoalanpencemaranlautyangseringkalilintas batas antar negara.Perhatianterhadap lingkungan terusberkembangdanstandarkualitas lingkunganjugameningkat, seiring dengankeberhasilan pengembangan IPTEK.Padatahun 1950-an,AmerikadanInggris-secaraparaleidansendiri-sendiri

16Merchant, 200217Markham, 1994
18MisalnyaFederalWaterPollutionControlAct.,yang disebut jugadenganCleanWaterAct.,pada tahun 1972, yang kemudian diikutidengan terbentuknya undang-undang lain sepertiGreat LakesWaterQyalifJAgreementdanOliPollutionAct,1990.6melakukanstudidanberhasil merumuskan hubungankuantitatifantaratingkatpencemaran bakteri pathogen atauindikatomyapadaairwisatarenangdengangejala penyakityangdideritaolehmasyarakatpenggunanya (Godfreeetal.1990). Sampai akhirtahun 1990-an telah banyakpenelitidiberbagai negarayangmenemukan modelkuantitatifyang khasuntuk negaranya,yangdapat menjadidasarpenentuan nilaibaku mutuairdilokasi wisatarenangdaerahpantai.Negara-negaratersebut diantaranyaadalahAmerika, Inggris,Mesir, Hongkong, SpanyoldanPerancis.Sejarah dan perkembanganinimemberi pesanbahwapengelolaan pencemaranlautdilakukan tidak hanya dalamkontekskorektifataupenanggulangan kecelakaan akibatpencemaran. Namun pengelolaanjugadiarahkan untukupayapreventifdanmenjadibagiandaristategidaya saingekonomidanindustri kelautan.

Hadirinsekalianyang berbahagia,
Ekonomi Pencemaran Laut
KementerianKelautan danPerikanan (KKP)menetapkantarget Indonesiamenjadi produsen perikananterbesardiduniapada2015, dengan perikananbudidayasebagai ujung tombaknyadanperikanan tangkapjugasebagai unggulannya.Namundemikianjikapersoalan pencemaranlauttidak diatasi,dalampandangankami,targetiniadalah tantanganyangsangatberatuntuk dicapai-jikatidakbolehdikatakanmustahil.Beberapaproduk perikananlautIndonesia mengalami penolakan pasarUniEropa karena pencemaran.Padatahun 2006 sampai pertengahantahun2007,terjadi17kasus penolakanakibatpencemaranlogamberatmercury(Hg),dan7kasus pencemaran logamberatcadmium(Cd)serta1kasuspencemaranlogamberat timbal(Pb).Bahkan sejak tahun1999 produk kekerangan Indonesia dicekalmasukkepasarUni Eropa (DKP2007),karenatidakdipanendari

7perairanyangdinyatakansebagaicerlifiedarea19Pencekalaninidapat dicabut apabila Indonesia dapat menunjukkandataklasifikasiperairan sebagai zona penangkapan kekeranganyangbersihdandimonitorsecarabaik20(Mukadardkk.2008).Padasektorpariwisata, pencemaranlautmengakibatkankerugianekonomi yangsangatbesar.Misalnya, selamapanas1987dan1988,pembersihanpantai(debriswash-up)akibatpencemaranlautdiNew York danNewJersey, AmerikaSerikat, mengharuskan penutupan akseskebeberapa pantai,sehingga terjadi penurunan penggunaanpantai dansporlfishing.Akumulasi kerugian ekonomi dari peristiwainidiperkirakanmencapai$379,1-$1597,8 juta (berdasarkan1987$)(OfiaraandBrown, 1999).Darisisi resiko kesehatan, dewasainitelahberkembangpemahamanhubungankuantitatifantarakeberadaanbakteripatogen didalamairdengan resiko penyakitsaluranpencernaan(gastroenteritis)padapenggunaperairanwisatarenang(Cabellidkk.1982).Studi kasus perairan KepulauanSeribu21(MukhtasordanMaulidiyah2005)menunjukkanbahwapeningkatanekonomidapat diperolehdenganperbaikanmutuperairan22,yaitu

19Certifiedareaadalah area penangkapan yang dinyatakan bebasdadcemaran logam berat, khususnya logam Hg, Pb, dan Cd, bakteripatogen sertabiotoxin(DKP 2004).
20Klasifikasi zona penangkapan yang berbasis kualitas perairan yangbaik akan mempermudah kegiatan monitoring terhadap perairantersebut secara periodik sehingga akan mudah mengetahui tingkatpencemaran yang terjadidantahun ke tahun (Mukadar dkk. 2008).
21Studi tersebut memperhitungkan biaya pengolahan/pembuangansewage,dan biaya kerusakan lingkungan yangterdiddadbiaya resiko””,ctrIlPntprjt;,dan biaya yang hilang akibat penurunan jumlahwisatawan.
22Berdasarkan asumsi-asumsi yang diadopsi, studi tersebutmendapatkan bahwa bakumutuE. Coli akan lebihdiperketat dari2001100ml menjadi1031100hingga130/100mL8nilaiekonomiyangdiperolehdariberkurangnyaresikokesehatandanmeningkatnya industri pariwisatadanperekonomianpendukungnya, serta perbaikan kondisi lingkungan.Studilaintentangresikokesehatan(OfiaraandBrown1999)melaporkanbahwadampakkonsumsi ikanyangterkontaminasipolutanberacun mengakibatkankerugianekonomiyangbesar.Untukkasus muarasungaiHudsondan NewYorkBight,konsumsiikanjenisstripedbass(popular sportfish)saja,yangterkontaminasiPCBpadahigh consumption(13,38 kg/tahun), berdampakpadakerugianekonomiyangmencapai $33690juta(berdasarkan1987$).Kitajugamasihingat kasusdiMinahasa,yangmenyedotperhatianpublikIndonesia, yaituterjadinyapencemarandiTelukBuyatyangdihubungkan dengan limbah tailing penambanganemas.Dilaporkanbahwa logamberatArsentelahmencemarisumur-sumurwargadiKampungRatatotokdanBuyat;danterjadipenimbunan zatmerkuridalam sedimen, ikan, rumput laut,danbatukarang.Denganperhitunganyanghati-hatidanbelummemasukkansemuaunsur kerugian (misalnyadampakkesehatan), Fauzidan Anna (2005)memperkirakankerugiankarenakerusakan sumberdaya alamdanlingkungan hidupdiBuyat sudah mencapaiangka60-116jutaUSD.DiJawa Timur,kitajugaingatkasusLumpurPanasLapindo Sidoarjo.Kerugianterkaitdengan semburan lumpurpanas tersebut,selamalima bulansejaksemburan pertama(29Mei2006-31Oktober 2006), mencapaisekitarRp.5(KNLHdan LPPMIPB2007).Nilaiitumemperhitungkankerugianakibat kerusakan lingkungan alamimaupunlingkunganbuatanmanusia. Daritotalbiayatersebut,kerugianakibatkerusakanpesisirdanlautmencapaihampirRp.2Trilyun.Kini,sudah lebihdariempattahun semburanlumpurbelumberhenti;dan dampaklumpurjugasudah lebihdahsyat lagi, apalagi setelah lumpurdialirkanmelaluiSungai PorongkemuaradiLautJawa.

9Dalamkasus pencemaran minyak,sumbernyalebihbanyak berasal dari pembuanganairtankibalastkapaltanker(Huijer,tanpatahun). Untuktankerberbobot50.000ton,buanganairdari tankibalastdapatmencapai 1.200barel(Bishop 1983).Kecelakaankapaltankerataukegiatan produksi minyak lepaspantaijugapentingdiperhatikankarenajumlah tumpahannyayangrelatifbesar,dalamwaktuyang singkatdan padakawasantertentusehinggaberdampakbesar. LedakandrillingrigBritishPetroleum(BP)PLCdiTeluk Meksiko,pada20April2010, membawa11orangkorban.Tumpahannya meluas hingga mencapai pantai,diperkirakan5000 barelperhari23Ini adalah tumpahan yangterburuksepanjang sejarah Amerika Serikat, melebihi peristiwakecelakaanExxonValdezyangmenumpahkan11jutagallonminyakpada 1989.Indonesia, peristiwa tumpahan minyak juga banyakterjadi24PadaAgustus2009,ladang minyakMontara diperairanAustraliamenumpahkansekitar500.000literminyak mentah perhari,mengalir bersama aruslautdanmasukkeperiaranIndonesiadiLautTimor (bandingkandenganminyaktumpahdiTelukMexico,5000barelper hari!). Perhitungan {MauludiyahdanMukhtasor2009)25menunjukkan bahwakerugianlingkungan

23National Oceanic and Atmospheric Administration(NOAA), US,memperkirakan 5000 bare!minyak tiap hari yang tumpah ke perairan.Berbeda dengan tumpahan dari tanker yang terbatas, peristiwa inibersumber darisumurbawah laut yang terus mengalirkan tumpahansampai kebocoran berhasil disumbat.
24Posisi Indonesia strategis bagi lalu lintas laut, dandan oroduksi minyak/gas banyak berada di laut. Kejadianlaporkan literatur, misalnya Mukhtasor (2007).
25Perhitungan dilakukan menggunakan pendekatan biaya totalkerugian fungsi dari volume minyak (Mauludivah&Mukhtasor, 2009). Asumsinya volume tumpahankarakteristik utama yang menentukan tingkat kontaminasi dandampaknya, serta jenis teknologi pembersihan yang digunakan.10kasustersebut sangatbesar.BerdasarkanpengalamandiEropa,untukukuran tumpahansebesaritu, kerugiannyabisa mencapaiRp.10Trilyun.Angka ini bisa lebihbesarjikakondisiperairanyangtercemaradalahperairankayakeanekaragaman hayatidanpadataktifitasekonomi.Para ahlimenghitung bahwakerugiansosial, ekonomidanlingkungandiperairan Indonesiayangmencapai luasan 70.000km2berkisarRp.17Trilyun.Angkainibisabertambahjikamemasukkan biayainvestigasi, administrasimaupunlegal.Berapapunangkanya, perhitungantersebuthanyamemberipetunjukawalatasbesaran skalabiaya.Kerugianyanglebihdefinitifperludiinvestigasidilapangan secarakomprehensifmelaluijointassessmentolehparastakeholders.

Hadirinsekalianyang berbahagia,
Padatahun1999,PemerintahAmerika(US.EPA1999)membandingkan antarapotensikeuntungandankerugianekonomiyangdiperolehdaripenerapanperaturan lingkungan,CaliforniaToxicityRules(CTR).Hasilnyamenunjukkanbahwakeuntungandarisektorkesehatan (resiko kanker), pariwisatadanpassiveusemencapai6,9-74,7jutaUSD(berdasarkan$1998). Sedangkanpotensi biayayangdibutuhkan untuk penerapanCTR(potentialannualcost)sekitar33,5-61jutaUSD(berdasarkan$1998).Apalagiadakeuntunganlain yangtidak semua bisa diuangkan,misalnya pengurangan jumlah polutanyangdiharapkandaripenerapanperaturan tersebutmencapai1,1-2,7jutatoxicIb-eqpertahun;atauterjadi penurunan15-50%daribebanpolutanperaturaninitidakditerapkan.Parameterekonomi,misalnya grossdomestic product(GDP),sering dijadikanukurankemajuan ekonomi suatuban’gsa.Jikamengabaikanekonomipencemaran,parameterGDPtersebutdapat bernilai semu,bias dan bahkan bisamenjerumuskan.Cinamembericontoh baik untukkasusin;(The World Bank 2007).EkonomiCinamengalamipertumbuhan ekonomidanindustrialisasiyangsangatpesat. Pertumbuhan ekonomitahunan
11Cinamencapai8 -9%,dantelahmengangkat sekitar400jutaorang keluar dari kemiskinan. Namun demikian,industrialisasiyangkurangramahlingkungan telah menciptakan persoalanbaruberupa kelangkaan air, pencemaranudaradanair,peningkatanpenyakit, peningkatanjumlahkematian dini,danpeningkatan kesenjangan sosialkarena bebanpencemaranlebihbanyak ditanggung oleh orang miskin daripadagolongan ekonomilainnya.Totalkerugian daripencemaranairdanudara sajapadatahun2003mencapai362-781milyarYuan,atausekitar2,685,78%dan GOP.Kerugianinibelum termasuk kerugiandiluarpencemaran udara dan air; daniniberarti bahwa angka.pertumbuhanGOP yangmengabaikan ekonomi pencemarandapatmemberisinyalyangsalah26

Hadirinsekalian yangberbahagia,
Teknologi Pencemaran Laut
Oalamkoteks peningkatan kapasitaspengelolaanpencemaran laut,analisispencemaran mencakupsekurang-kurangnyaenamsubyekbahasan,yaitumengenai(1)jenispolutan,(2)karakteristiklingkungan laut,(3)proses masuknyapolutankelingkunganlaut,(4)kualitaslingkunganlautsebelumdan sesudah masuknya polutan,(5)dampak polutan terhadapekosistem,dan(6)standarkualitas lingkungan laut sesuai denganalokasipemanfaatannya. Atasdasarpemahaman tentangsubyek-subyek tersebut,makateknologi-sebagai suatu sistemkemampuanuntuk peningkatannilaitambahbarang danjasadikembangkan untuk meningkatkan kapasitas pengelolaanpencemaran laut.

. k ‘ . k6Ekonoml pencemaran merupa an mstrumen pentmg untumenghidari kerugian yang lebih besardimasa depan(potential lost),dan meningkatkan daya saing ekonomi berbasis sumbedayaalamo12Adatigajenispolutanyangmasukkelingkunganlaut,yaitu berupa zat, organismedanenergj27.Jikaditinjaudari dayaurainya, polutan dibedakan dalam kelompok bahankonservatifdannon-konservatif28.Oalamdisiplinkajianresikokesehatan,adapolutan penyebab penyakit kanker(carcinogen)dan bukanpenyebabkanker(non-carcinogen).Pemahamantentangjenis-jenispolutaninitelah mengantarkan berkembangnya teknologimodernuntukmengklasifikasikan tingkatbahayasuatupolutandilingkungan29;danberdasarkanhaltersebut,priontas pengelolaanpencemaran laut dapat disusun(CovelloandMerkhofer1993,Fengetal.1989,Mukhtasoretal.2004,Neff1997,Saueretal.1997).’
Lingkungan lautadalahlingkunganyangkhas.Airlautmempunyaisifatfisikdanbergeraksangat dinamis3o.Lautjugamerupakanhabitatbagiberbagaijenistumbuhandanhewan.Olehkarena itu, ketika polutan masukkelingkungan laut, polutanmengalami proses fisika, proses kimia, dan prosesbiologi31.

27Tiga jenis polutan, yaitu zat (misalnya padatan tersuspensi, bahanorganik dan logam), organisme (misalnya bakteri dan virus pathogen),atau energi (misalnya limbah air panas dan radiasi limbah nuklir).
28Bahankonservatiftidak terurai atau bertahan lama berada dalamperairan laut, misalnya plastik dan deterjen; dan bahannon-konservatifadalah bahan yang relatifmudah terurai, misalnya minyak dan protein.
29Teknologi identifikasi jenis polutan telah berkembang maju danhasilnya telah tersediauntukpenelitian dan industri, misalnya dalambentuk basis data sepertiIRIS(Integrated Risk Information System).
30Dinamika laut ditandai dengan gerakan arus, pasang surut, ataugelombang laut. Kondisi dinamis ini besama dengan keadaan densitas,suhu, komposisi kimia dan salinitas air laut yang khas menyebabkanpolutan mengalami respontertentuketika memasuki lingkungan laut.
31Contoh proses fisika adalah pengenceran, penguapan, sedimentasi,transportasi oleh arus, dan difusi. Contoh proses kimia adalah reaksidengan zat lain atau oksidasi. Contoh proses biologi adalah keterlibatanpolutan dalam jejaring makanan (biokonsentrasi dan biomagnifikasi).13Namundemikian, prosesmana yangpalingdominan tergantungpadakondisilingkunganlautdansifatpolutan tersebut.Upayapemahaman tentang proses-prosestersebuttelah mendorongberkembangnyateknologiuntuk menjelaskan nasib polutanataumemodelkanfateandtransportpolutandi lauP2.Masuknyapolutankelingkungan lautbisasecaraalamiatauolehkegtatan manusia(anthropogenic)33.Darisegi sebaranlokasi sumbemya,sumberpencemaran adayangberupapointsources(sumbertitik)dannon-pointsources(sumberbukantitik)34.Darisegilamakejadiannya,adapencemaranyangbersifatrelatjfinstantatauseketika,dan ada yangkontinyu. Masingmasingkasusitumempengaruhiintensitasinteraksi polutandenganmanusiakhususnya,danekosistempadaumumnya35.

32Berbagai penjelasan atau model matematikadanmodel nsik, denganpendekatan deterministik ataupun probabilistik, telah diajukan olehbanyak peneliti pencemaran laut (misalnya Brooks 1960, Fischeretal.1979, Reedeta1.1996, Mukhtasor 2001, Mukhtasor andLye2004,Mukhtasor dkk. 2002b, 2003, 2005, Mukhtasoreta1.2001,Mukhtasor dkk. 2006, Niueta1.2009, danTurner2010).
33Contoh pencemaran alami adalah pencemaran akibat gunungmeletus; sedangkan pencemaran oleh kegiatan manusia(anthropogenic)misalnya adalah pembuangan limbah kegiatan perikanan.
34Pointsources(sumber titik) , yaitu sumber pencemaran yang dapatdidefiniskan dengan jelas, misalnya anjungan yang tenggelam.Sedangkannon-pointsources(sumber bukan titik) adalah sumberpencemaran yang tidak terlokalisir secara dennitif, misalnya buanganlimbah rumah tangga yang tidak terintegrasi di sepanjang pantai.35Sebagian besar pencemaran anthropogenic terjadi didalam ataudekat daerah hunian, atau di areal industri. Ini berarti bahwa polutan~seringkali terkonsentrasi lebih tinggi di lokasi yang memungkinkanintensitas interaksi yang tinggi antara polutan dengan manusia.14Teknologidibidang ini berkembang untuk kasus-kasusyangspesifik36.Setiap pencemaran berpengaruh pada kualitasIingkungan37.Teknologi untuk karakterisasi lingkungan telahberkembang, terutama untukaplikasipemantauan kualitasairlaut,baik dengancarain-situmanual,otomatic continuous samplingmaupun denganteknik penginderaan jauhatauremotesensing.Metode pemantauan kualitas lingkunganpadabadanairataudasar lautjuga dikembangkan denganbantuanrobotbawah air,baikyangdiopersikandengan kabel maupun robotkapaltanpaawak.Pendekatanwaterqualityindexjuga tersediauntukpenilaiankualitasairberdasarkanparameteryangjumlahnyabanyak, dengan kondisi lingkunganyangdinamik dalamkurunwaktupengurukuranyang lama(misalnyaHusainetal.1999).Pengaruhpolutanpada ekosistemdapatdikelompokkankedalamdampak sosial, dampak ekonomidandampaklingkungan.Dampak terhadap biotalautterdiridari pengaruhjangka pendek(acute)danpengaruhjangkapanjang(chronic).Metodologiecotoxycologytelah berkembang pesatdanhasilnya

36Misalnya model CORMIX(asymptotic-basedsystem,steady state)untuk ocean oulfall (USEPA1991a), model matematika difusiturbulen (Brooks 1969), model numerik(unsteady state)untukpencemaran lokal pada pembuangan limbah panas dariPLTU(Mukhtasor dkk. 2003, Zaman dkk. 2006), model numerik(unsteadystate)3-Duntuktumpahan minyak dari kapal tanker (Mukhtasor dkk.2005), model hidrodinamika untuk buanganproduced waterberbasispendekatan probabilistik (Mukhtasor 2001), dan kajian resikolingkunganuntukperairan semi-tertutup dengan pengaruh aktifitasmanusia (Khairyetal.2009).37Kualitas lingkungan meliputi kualitas fisik (misalnya kandunganpadatan tersuspensi), kualitas kimia (misalnya kandungan logam danhidrokarbon), atau kualitas biologi (misalnya kandungan bakteri).15telah diterapkan untuk penanganan pencemaranlaut38.Teknologiuntukpenilaianekonomijuga telah berkembang untukmenghitungkerusakan sumberdayaalam danuntuk menghitung besaran klaimgantirugipencemaran laut(Fauzi 2004,Grigalunasetal.1989,MauludiyahdanMukhtasor2009, Remoundouetal.2009).Pencemaranmenyebabkan perairan tidak dapat berfungsisebagaimana mestinya, sehingga alokasi pemanfaatannya akanberubah. Kesesuaian perairanlautuntuk pemanfaatantertentudinilaiberdasarkanstandaryangdisebutbaku mutu39.Misalnya,baku mutuair laut Indonesia berdasarkanKepmenLHNO.51/2004mengatur kualitasairuntuk pemanfaatan pelabuhan, wisata baharidanbiota laut.Teknologiyangmendasari penentuanbakumututelah berkembang,darisangat sederhanadankualitatif,sampaidenganyangkuantitatif40(Mukhtasor2007, Godfreeetal.1990).

Hadirin sekalian yang berbahagia,
Dariwaktukewaktu, perkembanganIPTEKmeningkatkanketelitian,keakuratan,efisiensi, efektifitasatauproduktifitaspadametodologi,teknikdaninstrumen pengelolaaan pencemaran laut.

38EcotoxycoI0aYadalah disiplinilmuyang mempelajari dampak negatifbahan kimia terhadap makhluk hidup, khususnya yang terkait denganpencemaran lingkungan.Contohpenerapannya misalnya didalamperaturan perundangan(misalnya USEPA 1991b), penanganan paskakejadianpencemaran(French andFrenchIII1989), kajian perancanganfasilitas industri (MukhtasoretaI.2004),danhuman health andecol0aYcaI risks assessment(Mukhtasor2001,MukhtasoretaI.2001,MukhtasoretaI.2002,Mukhtasor 2004).
39Bakumutuadalahukuranbatas zat, organisme atau energi yangharus ada ataupolutanyang ditenggang keberadaanyadilingkungan.40Pendekatan epidemiologi dan kajian resiko ekologi dan kesehatanjuga telahberkembanguntuk penentuanbakumutuair laut(GodfreeetaI.1990, MukhtasoretaI.2004,Mukhtasor danHartoyo2004,Mukhtasor dan Mauludiyah 2005).16Perananteknologisemakin penting, seiringdenganperkembangandanpemutakhiran IPTEK tentang pencegahan,pengendalian, penanggulangan, pemulihandanpemantauanpencemaran laut.Dalam konteks pencegahan, teknologi diarahkan untukusahamitigasipencemaran laut, pemilihan bahan-bahanyanglebihramahlingkungan dalam prosesindustri,perencanaanmenejemen lingkungandenganpendekatanup-to-date,pengembanganbaku mutulingkungan,penataan kelembagaanpengelolaan lingkungan laut,danpemberlakuan peraturanperundangan tentangperlindungandanpengelolaanlingkungan41.Untuk konteks Indonesia, telahadaamanatUUbahwa biayadampak lingkunganataueksternalitasharuslah dimasukkandalampenilaian biaya kegiatanatauusaha ekonomi, sebagaimanatercermin dalamUU30/2007tentangEnergidanUU3212009tentangPerlindungandanPengelolaan Lingkungan Hidup.Pengendalian pencemaran laut diarahkanuntukmemastikan adanya usahapengendalianlimbah-limbahyangdihasilkan oleh proses produksipadaindustridankegiatandomestik, sebelum akhirnyasisakegiatanataulimbah tersebutdibuangkelingkungan laut secara aman. Ahmadunetal(2009),misalnya, mengkajiulangberbagaijenisteknologiyangtersediasaatini danbiayanya untuk pengendalian dampakproducedwaterdariproduksi minyak/gas, baik dari segi pengolahanmaupunpembuangannya42.Untuk penerapandianjungan tengah laut,

41Dewasa ini telahberkembangpenelitian dan usaha-usahauntukmemasukkan resiko lingkungan dalam akuntansi finansial industri,sehingga resiko kecelakaan yang besar dapat dicegah denganproaktifmenyelenggarakanprogram-programsebelum atau selama kegiatanberlangsung.42Perludicatata, tidak adasatupunteknologi yangcocok untukmengolah limbahproduced watersecara tuntasj dua atau lebih sistemteknologiperludikombinasikan secara serio Meskipunproduced waterpada dasamya adalah beracun, level teknologi saat ini sudahmampu17sistem pengolahan secarafisikdan kimia sudahdapatdisediakandalam ukuranyanghemat tempat.Penanggulangan pencemarandilakukanketika kejadianpencemarantelahterlanjurterjadLPenanggulangan diarahkanuntukmelokalisirdampak pencemaran, memindahkanbahanberbahayaketempatyangsemestinya,danmembersihkanpolutan dari lokasi pencemaran. Metode penanggulanganfisikdankimia banyak digunakan, misalnyaoilboom,oilskimmer,absorbent,dispersant,danpembakaranuntukpenanggulangantumpahan minyakdilaut(Mukhtasor2007).Ketikapencemarante~adidan dampaknya telahditanggulangi, makasisa-sisapolutan perlu dibersihkan untukmemastikan kualitas lingkunganlautmembaik kembali, melaluikegiatanpemulihan,atau yangdiistilahkandengan remediasLTeknologi pemulihansangattergantungpadajenispolutandankondisi lingkungan. Untukkasusminyak tumpah, misalnya,teknikremediasiyangpaling banyak digunakan adalah teknikbioremediasi (MunawardanMukhtasor2007, Munawar dkk.2007). Pengembanganteknologibioremediasi dengan teknikbiostimulasi telah dilaksanakandiITS danmenghasilkankomposisi peletyangcocok untuk aplikasi wilayahpesisir(Mukhtasor2008,Munawar 2010).

Hadirinsekalianyangberbahagia,
Penutup
Tantangan pembangunan kelautan semakinhankiankompleks43.

mengolah sampai kualitas yang mememuhi syarat untuk penggunaanulang, termasuk mampu mengolah samapai setara dengan kualitas airminum (AhmadunetaJ.2009).
43Pertumbuhan pusat-pusat ekonomi baru yang sebagian besar terletakdikota-kota pesisir juga menghadirkan tantangan baru, khususnyadalam pengelolaan pencemaran laut.18Kebijakan pembangunan membutuhkanperspektifekonomi dalammengapresiasi nilai sumberdayapesisirdanlaut dalamrangkamemeliharanya dari persoalan pencemaran. Remoundouetal(2009)jugamenunjukkan bahwa nilai ekonomi sumberdayapersisirdanlaut, baikyangdapatdiperdagangkanmaupun yangtidak dapat diperdagangkan, memberi pembenaran ataspentingnyapemanfaatan danpengelolaannyasecaraberkelanjutan, termasuk melalui pengelolaan pencemaran laut.Halmembutuhkan dukungankapasitas metodologi, teknikdaninstrumen untuk pencegahan, pengendalian, penanggulangan,pemulihandanpemantauan pencemaran laut. Teknologipencemaranlautyangtelah berkembang dewasainimenyediaakan dukungan peningkatan kapasitas tersebut.Dariperspektifekonomi danteknologi,sesungguhnya,pengelolaanpencemaranlauttidak dimaksudkanuntukmenghentikan semua kegiatan ekonomiyangberpotensimenghasilkanlimbah.Pengelolaan pencemaranlautlebihdimaksudkan untuk mengendalikan polutanyangbolehdantidakboleh dibuangkelaut, dengan memperhatikansifatpolutan,dampaknyaterhadaplingkungan, kesesuaiannyadengan keadaanlokasi kegiatan,carapembuangannyadanpersyaratanrelevanlainnya.Alasanuntukperspektifiniadalah,pertama,semuakegiatan manusia dalam skalabesarmaupun kecilselalumenghasilkan limbah. Menghentikan produksi limbahsecaratotalsamadengan menghentikan kegiatan pembangunan.Dalamkonteks ini pengelolaan pencemaran diarahkan untuk mengurangijenisdan jumlah polutan sebagai hasil sampingkegiatanpembangunantersebut.Alasan keduaadalahbahwapesisirdanlaut memiliki kapasitas asimilasi-dalam skala tertentu-untukmemproses ataumendaurulangpolutanyangmasuk kedalamnya.Olehkarenaitu,persoalannyabukanpadaboleh atau tidaknyamembuang limbah, tetapi dimana dibuangya, bagaimanamembuangnya danapapersyaratannya.
19Ekonomidanteknologipencemaranlaut merupakanfaktorpenting perbaikanpengelolaanpencemaranlaut.Berdasarkanpengalaman dan pengetahuanyangberkembang dewasa ini, kitasemakin yakin bahwa kegiatanpengelolaanpencemaranlautbukanlahpemborosan;tetapisebaliknya,merupakaninsentifproduktifbagi pembangunan ekonomi. Pembangunanekonomiyangtidakramahlingkungan menghasilkanpertumbuhanekonomiyangtinggidisatu sisi,dankerusakanlingkungandankesenjangansosialdisisiyanglain;daniniberartibahwaparameter pertumbuhanekonomiyangmengabaikanekonomipencemarandapatmemberi sinyalyangsalah.Selanjutnya,kemajuanteknologidewasa ini telah memungkinkan bahwapengelolaan pencemaranlaut dilakukantidaksaja dalamkontekskorektifataupenanggulangankejadian pencemaran;namunjugapreventifdanmenjadi bagian daristategidaya saingekonomikelautanyangberbasis sumberdayaalam, misalnyaindustri wisatabaharidanperikanan.

Hadirin sekalianyangsaya hormati,

Padabag ianakhirini,kamiinginmengungkapkanrasasyukurkepadaAllahSWT,yangtelah melimpahkankaruniayangtidakterhitung. Hanya denganpertolongan-Nyasaya mampumelaksanakan tugashinggasampaipadapengukuhan pagiini.Saya memohon do’a restu padahadirinsemua, semoga sayadapatmengemban amanah sebagaiGuruBesar dengansebaikbaiknya, sebagai wujud rasasyukkurdan pengabdian sayakepada Allah SWT, dansebagaipelaksanaanpesanRosulullahSAWagarkitamenyebarluaskankemanfaatanyangterbaik.

Selanjutnyasayamenyampaikan penghargaandanucapan terima kasihyangsebesar-besarnyakepada:1. BapakMenteri PendidikanNasional,Prof.Dr.MohammadNUH,
202. BapakRektorITS,AnggotaSenatITS,DekanFTK,KetuaJurusan TeknikKelautan,KoordinatorBidangLingkungandanEnergi Laut,dan KetuaLaboratoriumLingkungandanEnergiLaut.
3. Para PimpinanDewanEnergi Nasional, yaituyang kamihormatiBapakPresidenRI,Bapak WakilPresidenRI,danBapak MenteriESDM,sertarekansejawat AnggotaDewanEnergi Nasional, baik dariunsurPemerintah, yaitu MenteriKeuangan, MenteriPerindustrian,Menteri Perhubungan,Menteri PerencanaanPembangunan/KepalaBAPENAS,Menteri Pertanian,MenteriRisetdanTeknologi,dan MenteriLingkunganhidup, serta anggotadariunsurpemangkukepentingan,Ir.AgusmanEffendi,Dr.Ir.Herman DarnelIbrahim,M.Sc., Prof.Dr.Widjajono,Prof.Dr.HermanAgustiawan,Dr.Ir.Tumiran,Ir.EddieWidionoS.MSc.danProf.Dr.Rinaldy Dalimi, danjugakawan-kawan dariSekretariatJenderalDewanEnergi Nasional. Secarakhusus,sayamengucapkanterimakasihkepadaBapakDidaMigfarataskerjasamanyadalammelaksanakantugasDewan EnergiNasionaldibidanglingkunganhidupdanjugadidalammemberi dukunganpadapenulisanmakalah orasiini.

Secarakhusus, darilubukhatiyangpaling dalam, sayamenyampaikanpenghargaan, ucapanterim~kasihsertairingando’a,kepada:1. Orangtuatercinta,IbundaHj.Suratemi(almarhumah)danBapakH.IswandiShodiq,yang telahmembesarkan,mendidik,danmembimbing saya,serta memberikando’adan ridlonya.AJlahummaghfirlaha warhamhawa’aafiha wa’fu’anha.Amiin.
2. Bapak danIbumertua saya,H.Erboe KadjimdanHj.Rodliyah, atas segaladukungan,bantuan, kesabarandando’a-do’anya untukkamisekeluarga.

21..

3. Istri sayatercinta, AdindaRatriHandayaniS.Si.atascintadankesetiaannya, kebaikandankesabarannya, dukungandansemangatnya, kerjakerasdanpengorbanannyadalammelaksanakan tugas-tugasdanmewujudkancita-cita.Jazakillahkhairan katsira.
4. AnandatercintaAbduhMuhammadFatih, AhmadShidqi,Asmahana,danAhmad Faaiq,yangmemberikan dorongansemangat, menyejukkan jiwa,danmemberikan kebahagianyangtidak ternilai.Semogaselalusholih-sholihah, muslihmuslihah,giat belajar,danmenjadiorangyangberdayadanmemberdayakan. Amiin.
5. AsatidzdanAsatidzahsaya,tempatsayabelajardanbersama-sama untukmeng-ikhlash-kanniat,mencerahkanpikiran,bersatudalam’ikatanukhuwah,danistiqomahdalampengabdiandanberkarya,danjugakhususnya kepadaKHAhmadMudzofar,MAdanIr.Sigit Sosiantomo.Jazakumullahu khairaljaza’.
6. Para gurusaya, mulaiSD, SMP dan SMA,sertapara dosensayadiITS, danjugadosen wali saya,BapakIr.MintaYuwana,MS.dan parasupervisorselamasayakuliahdiMemorialUniversityofNewfoundland,Canada,yaituyangkamihormatiProf.Dr.JamesJ.Sharp,Prof.Dr.LeonardM.Lye,Prof.Dr.TahirHusain,Prof.Dr.Neil Bose,danProf.Dr.BrianVeitch.
7. Prof. DanielM.Rosyid, Ph.D, yangtelah banyakmemberiinspirasi,supportdankerjasama dalam menjalankan profesisebagai pendidik, penelitidanpenggiat pengabdianpadamasyarakat melalui program-programPascaSarjanaLinkdanSandwich (ITSdan UNT),Konsorsium Kemitraan Bahari,danPusatKelautanITS.Jugakepada Prof.Dr.RokhminDahuri,mantanMenteriKelautandanPerikanan,danProf.Dr.DietrichBengenatas supportdaninspirasinyadalam menulis danberkaryadiduniakelautanIndonesia.
8. Sahabatdan kolega kerja sayadalambelajardanberkaryadibidangHuman andEcologycal Risk Assessment,Prof.Dr.Rehan Sadiq(ProfessorintheUniversityofBristishColumbia,Canada);
9. Keluargabesardosen,karyawandanmahasiswa JurusanTeknik KelautanITS,yangmemberikan dukungandalamI,suasana kerjayang akrab,hangatdandinamis.
10. Sahabat dekatsaya,AkhunaAminAk. MM,yangtelahlamabersama-sama belajar menyeimbangkan tugas-tugasprofesi,sosialdankeluarga-terimakasih atas inspirasisurvivaluntukmenghadapi tantangan kehidupan.
11. Saudara-saudaradankeluarga besardariBlitardanLamongan,dankhususnya kepada Kakak-kakakdanadik-adiksaya: Mbak Tik,MbakTi’in(almarhumah),Mas Kom,DikYun,DikPur,dan Dik Anang, dankeluarga.
12. Teman-temansejawatdiMitra Bahari, HimpunanAhliPengelolaPesisirIndonesia (HAPPI), MasyarakatIImuwandanTeknolog Indonesia (MITI),InstituteforSciencesandTechnology Studies (ISTECS),dan IkatanAlumniITS.
13. KeluargaBesarYayasanMarkazDakwah,YayasanUkhuwahIslamiyah,YayasanPengembanganSDMIPTEK,YayasanLembaga MenejemenInfaq(LMI),JaringanSekolahIslamTerpadu, Yayasan Persaudaraan Mualaf,TimPembinaKerohanianIslam ITS,Jama’ahMasjidManarulIImi,danKeluarga BesarRT02/RW07Keputih.
14. Parasekretaris,asistendanmahasiswa-mahasiswiProgramSarjanadanPaskasarjana,yangselalubahumembahudalambelajar, meneliti,bekerja danmelaksanakan pengabdianpadamasyarakat: Maulidiyah, Naili, Vita,Danik, Dewi, Erny,
22 23 Sandra, Pak Bambang, Pak Choirul(almarhum),PakMunawar, Bagus,Estudansemuanyayangtidakbisa sayasebutsatupersatu disini.
15. SeluruhpanitiapengukuhanGuruSesarpagiini dansemuafihakyangtelah memberi dukungandanbantuannya.

Demikianlah,ataskehadiran,perhatian,kesabaran dandoa restu parahadirin semuanya, saya menyampaikanterimakasihyangsebesar-besarnya danpermohonanmaafatassegalakekurangandankekhilafankami. Semoga Allah SWTmemberi hidayah,selalumembimbingdanmeridhoi kita semua.

Wassalamu ‘alaikumwarahmatullahiwabarakaatuh.

Daftar Pustaka
Ahmadun,F.,Pendashteh,A.,Abdullah,L.C., Biak,D.RA,Madaeni, S.S., Abidin, Z.Z., 2009,ReviewofTechnologies forandGasProducedWater Treatment,Journalof
Hazardous Materials,170: 530-551.
AIFaruqi, IsmailRaji andAIFaruqi,Lois Lamya, 1986,TheCulturalAtlasofIs/am,Macmillan Publishing Company, NewYok,512pp.
AI-Haritsi, JaribahbinAhmad, 2006.Perlindungan Lingkungandalam Fikih EkonomiUmar RadhiyallahuAnhu,diambil dariFikihEkonomi Umarbin AI-Khathab,PustakaAIKaulsarGrup,http:www.dkmfahutan.wordpress.com/…IperlindunganIingkungan-dalam-fikih-ekonomi-umar-radhiyallahu-anhu-31
Bishop,P.L.,1983,MarinePollution andItsControl,MC.GrawHillBookCompany,USA.
Brooks, N.H. 1960, DiffusionofSewageEffluentin anOceanCurrent,inProceedingsoftheFirst InternationalConference

24onWasteDisposalin theMarine Environment,EditedbyPearson, E.A., Pergamon,pp.246-267.
Cabelli,V.J., Levin,MA,Dufour, A.P., 1982.EstuarineInfectiousDisease.OceanDisposalofMunicipalWastewatersImpactsonthe Coastal Environment,Vol1519-576.
Covello, V.T. and Merkhofer,M.W.1993.RiskAssessmentMethods:Approaches for AssessingHealth andEnvironmentalRisks.Plenum Press, New YorkandLondon.
Departemen Kelautan danPerikanan,2004.SuratKeputusanMenteri Kelautan danPerikanan,No.KEP.17/MEN/2004tentangSistemSanitasiKekerangan Indonesia.
Departemen KelautandanPerikanan,DiijenKelautanPesisirdanPulau-PulauKecil (KP3K), 2001.NaskahAkademikUndangundangPengelolaanWi/ayahPesisirdanPulau-pulauKecil.
Departemen KelautandanPerikanan,DitjenPengolahandanPemasaran Hasil Perikanan (P2HP), 2007.UERAS-20062007,Jakarta. (tidak dipublikasikan)
DewanKelautan Indonesia,tanpatahun.NaskahAkademikNationalOcean Summit,SekretariatDewan KelautanIndonesia, Jakarta,19 halaman.
Fauzi,A.danAnnaSuzy,2005,Assessment PerhitunganGantiRugiKasus Dampak PenambanganPT.NewmontMinahasaRaya:PreliminaryDraft,Submittedto Kementrian LingkunganHidupRI(tidak dipublikasikan).
Feng,S.,Reed,M. andFrench, D.P., 1989, The ChemicalDatabaseforthe Natural Resource DamageAssessmentModel System,Oil&Chemical Pollution,5:165-193.
Fischer,H.B.,List,E.J.,Koh,R.C.H.,Imberger,J,and Brooks,N. H.,1979,MixinginInland and Coastalwaters,AcademicPress, New York.

25French, D.P. andFrench III,F.W.,1989,TheBiologicalEffectsComponentofthetheNatural Resource DamageAssessmentModel System,Oil&ChemicalPollution,5:125-163.
Godfree,A.,Jones,F., and Kay,D.,1990,Recreational WaterQuality,TheManagementofEnvironmental Health RiskAssociated with Sewage Discharges,MarinePol/utionBulletin,21(9):414422.
Grigalunas,T.A.,Opaluch,J.J.andTyrell,T.J.,1989,TheEconomic Damages Componentofthe theNatural ResourceDamageAssessment Model System,Oil&ChemicalPollution,5:195-215.
Huijer,Keisha,__,TrendsInOilSpillsFromTanker Ships1995-2004,InternationalTankerOwners Pollution Federation(ITOPF),London, United Kingdom.
Husain,T.,Khan,A.andMukhtasor1999,DevelopmentofWaterQuality IndicesforNorthwestTeritory, Canada,ProjectReport,MemorialUniversityofNewfoundland.
KementrianNegara Lingkungan Hidup(KNLH) dan LembagaPenelitian dan Pengabdian Masyarakat (LPPM)InstitutPertanianBogor(IPB), 2007,UpdatingValuasi EkonomiKerugianSemburan LumpurPanasPT.LapindoBrantas,Inc.,PorongSidoado,LaporanAkhir(tidakdipublikasikan).
Khairy,M.A.,Kolb,M.,Mostafa, A.R., EI-Fiky,A.,andBahadir,M.2009. RiskAssessmentofPolycyclicAromaticHydrocarbonsInAMediterranean Semi-Enclosed Basin AffectedbyHumanActivities(Abu QirBay,Egypt).JournalofHazardousMaterials(170): 389-397.
MauludiyahdanMukhtasor, 2009, Perhitungan SkalaBiayaKerugianakibatTumpahan Minyak: Relevansinya untukPerairanIndonesia,Prosiding Seminar NasionalTeoridanAplikasiTeknologi Kelautan2009,ITS,ISSN:14122332,hal.A.119-A.128.

26Mukadar,S.,Mukhtasor, Aunurohim,2008.StudiBioakumulasiLogamBerat(Hg,Cd danPb)pada KekerangandiPesisirSidoado,SeminarNasional PascasarjanaVIII-ITS2008.
Mukhtasor, 2008,TeknologiBiostimulasi padaProsesBioremediasiTumpahanMinyak diWi/ayahPesisir,LaporanPenelitianHibah Bersaing,PenelitiUtama,LPPM ITS,didanaiolehDirjen DIKTI, Diknas,2007-2008.
Mukhtasor,2007,PencemaranPesisirdanLaut,PradnyaParamita, ISBN: 978-979-408-541-7, CetakanI,Jakarta,322hal.
Mukhtasor,2004,TeknologiOceanOutfall untuk daerahWisataRenangPerairan PantaidenganMemadukan AspekHidrodinamika EffluendanResikoKesehatan,LaporanPenelitian Hibah Bersaing,PenelitiUtama, didanai oleh DirjenDIKTI, Departemen PendidikanNasionaI2003-2004.
Mukhtasor,2003,PengembanganDecisionSupportSystemMinyakTumpahdiLaut, KerjasamaInstitutTeknologiSepuluh Nopember (ITS) dengan Departemen KelautandanPerikanan.
Mukhtasor, 2001,Hydrodynamic Modeling andEcologicalRiskbasedDesignofProducedWaterDischargefrom an OffshorePlatform,Ph.D.Thesis, MemorialUniversityofNewfoundland,pp.244.
Mukhtasordan Hartoyo 2004, Metode PenentuanNilaiBakuMutuPerairan pantaiuntuk Logam MerkuridanKadmiumBerbasisResiko KesehatandanBiaya,Jurnal TeknologiKelautan,8(1): 23-32.
Mukhtasorand L.M. Lye2004,UseofResponse SurfaceMethodology forExtractingAModelfromanArtificialNeuralNetwork:ACaseofInitialDilution Modeling,Proceedingsof1stWaterandEnvironmentSpecialtyConferenceofthe

27CanadianSocietyofCivilEngineering,CSCE,Saskatoon,Sascatchewan,Canada,WE.56.1-WE.56.11.
MukhtasordanMaulidiyah,2005,AnalisisResiko KesehatandanBiaya PengolahanLimbahpada EvaluasiBakuMutuAirLautuntuk BakteriEscherichiacoli(Studi Kasus: DaerahWisataKepulauanSeribuJakarta),JurnalTeknologiKelautan(terakreditasi),ISSN: .1410-2919,9(2):92-98.
Mukhtasor,Zulaika,E.,Susilowati,E.,Pudjiastuti,L.,Setiawan,P.R.,Widiadi, J.B.,Musfil,Suprapti,Triwulan,Leliyana,D.,danMaulidiyah,2008,PengantarIImuLingkungan,ITSPress.ISBN:979-8879-18-8,CetakanI,Surabaya,302hal.
Mukhtasor,SujantokodanEstuP.Pribadi,2006,PengembanganTeknikPercobaanOceanOutfalluntuk Limbah Panasyangdilepas dariAnjungan MinyakLepas Pantai,ProsidingSeminarTeoridanAplikasiTeknologi KelautanVI,FakultasTeknologiKelautanITS,Surabaya,hal:192-199.
Mukhtasor,Totok Akbar Sriyudianto,SuyadidanHaryo Armono,2005, PemodelanOilSpillsdi Perairan Laut: Studi KasusValidasiSoftwareOILMAPW,Prosiding SeminarTeoridanApliokasiTeknologi KelautanV,Fakultas TeknologiKelautanITS,ISSN: 1412-2332, hal:111.98-111.104.
Mukhtasor,TahirHusain, Brian Veitch, Neil Bose, 2004,AnEcological RiskMethodology forScreening DischargeAlternativesofProduced Water,Human andEcologicalRiskAssessment:AnInternationalJournal,HERA,10(3):525-542.
Mukhtasor,Setiawan,R.E., Ikhwani,H.2003, SimulasiPenyebaranLimbah Panasuntuk Analisis PerancanganSistemSirkulasi AirPendingindiWilayahPesisir,ProqeedingsSeminar NasionalTeoridanAplikasiTeknologiKelautan,FTK-ITS, Surabaya.
Mukhtasor, Husain,T., Lye,L.M.andSharp J.J. 2002a, HumanHealthRisk-basedDesignofOceanOutfall,Waterand

28Maritime Engineering,ProceedingsoftheInstitutionofCivilEngineers,London,UK,154,issue#1: 29-39.
Mukhtasor,Lye,L.M.andSharp J.J. 2002b,ANewApproachtoInitial DilutionofBuoyancy-dominated JetinMoving Water,JournalofEnvironmental Engineering andSciences,1:101111.
Mukhtasor,SadiqR.,Husain,T.,Veitch,B.andBose,N.2001,AcuteEcologicalRiskAssociatedwithSoot Deposition:APersianGulfCaseStudy,OceanEngineering,28(9): 12951308.
Mukhtasor,Lye,L.M. andHusein,T.,2000,Problems ofAsymptotic Solution-based InitialDilutionModels and NewResearchDirection,ProceedingsoftheConferenceofCanadianSocietyofCivilEngineering,London,Ontario.
Mukhtasor,Sharp, J.J.andLye,L.M. 1999a,UncertaintyAnalysisofOceanOutfalls,CanadianJournalofCivil Engineering,26:434-444.
Munawar, 2010,BioremediasiTumpahan Minyak dengan TeknikBiostimulasidiLingkunganPantai,DisertasiDoktor,FakultasTeknikKelautan-ITS.
MunawardanMukhtasor, 2007,Pengujian Nutrien Anorganikuntuk BioremediasiTumpahan Minyak Mentah denganMetodeBiostimulasidiLingkunganPantaiSurabayaTimur,JornalPurifikasi(terakreditasi), JurusanTeknik LingkunganFTSP-ITS,ISSN:1411-3465,8(2):151-156.
Munawar,MukhtasordanTiniSurtiningsih,2007,BioremediasiTumpahanMinyakMentahdenganMetodeBiostimulasiNutrien OrganikdiLingkunganPantaiSurabayaTimur,BerkalaPenelitian Hayati (JournalofBiologicalResearches)(terakreditasi),PerhimpunanBioJogiIndonesiaCabang JawaTimur, ISSN: 0852-6834,13(1):91-96.

29Neff,1997,Metals and Organic ChemicalsAssociatedwithOil andGasWellProducedWater:Bioaccumulation,Fates,andEffectsinthe MarineEnvironment,GulfofMexicoProducedWaterBioaccumulationStudy,ContinentalShelfAssociates,Inc.for OffshoreOperatorsCommittee, April.
Niu, H.,T.Husain,B.Veitch,andN.Bose,K.HawboldtandMukhtasor,2009,Assessing Ecological RisksofProducedWater DischargeinaWavy Marine Environment,AdvancesinSustainable Petroleum Engineeringand Science.1(1).
Ofiara,D.D.andSenecaJ.J.,2006,Review:Biological EffectsandSubsequent Economic Effectsand LossesfromMarinePollutionandDegradationsinMarineEnvironments:Implications fromTheLiterature,MarinePollutonBulletin52,p.844-864.
Reed,M.andNittis,K.,2001.IntroductiontotheSpecial IssueofMarine Pollution Bulletin: SelectedPapers from theFourthInternationalMarineEnvironmentalModellingSeminar,Athens, Greece, October 2000,MarinePollutionBulletin,43(7-12):143-144.
Reed, M.,Johansen,0.,Brandvik, P.J., Daling,P.,Lewis, A.,Fiocco,R,Mackay,D.,Prentki,R,1999,OilSpill Modellingtowards theCloseofthe 20thCentury: Overviewofthe StateoftheArt,SpillScience&Technology Bulletin,5(1):3-16.
Remoundou,K.,Koundouri,P.,Kontogianni, A., Nunes,PAL.D,andSkourtos,M.,2009, ValuationofNatural MarineEcosystems:anEconomic Perspective,Review,EnvironmentalScience&Policy,12:1040-1051.
Roberts,DA,Johnston,ELandKnott,NA,2010, Impactsofdesalination plant dischargesonthe marine environment:Acritical reviewofpublished studies,Water Research,Elsevier.
The World Bank, 2007,CostofPollutioninChina:EconomicEstimatesofPhysicalDamages,TheState Environmental

30Protection Administration,P.RChina,RuralDevelopmentNatural ResourcesandEnvironment, Management Unit, EastAsiaPacificRegion, TheWorldBank, pp; 128.Turner, A., 2010,MarinePollutionformAntifoulingPaint Particles,MarinePollutionBulletin,60:159-171.
U.S. EnvironmentalProtection Agency(EPA), 1999,EconomicAnalysisOfTheCaliforniaToxicsRule,PreparedbyScienceApplication International Corporation(SAle).
U.S. Environmental Protection Agency(EPA)1991a,CORMIX2:AnEXPERTSystemfor Hydrodynamic Mixing Zone AnalysisofConventional andToxicMultiport DiffuserDischarges,USEPA,OfficeofResearchandDevelopment, Washington,DC.,EPAl600/3-911073.
U.S. Environmental Protection Agency (EPA)1991 b,TechnicalSupport Document for Water Quality-basedToxicsControl,USEPA,OfficeofWater,Washington,DC.,EPAl505/2-90001PB91-127415.
Waldichuk,M., 1973,International Approachtothe MarinePollution Problem,OceanManagement1,pp.211-261.
Zaman, B.,Mukhtasor, Sujantoko, 2008, Pemodelan PenyebaranPanasdariBuanganPembangkit ListrikTenagaUap (PLTU)diPerairan Pantai,ProsidingSeminarNasional,TeoridanAplikasiTekno/ogi Kelautan2008:RekayasaEnergi untukAplikasiTeknologiKelautan,ITS, hal:0159-0168

31 DAFTARRIWAYATHIDUP

Nama:Mukhtasor
NIP:196904201994031003Tempat,tanggallahir:Blitar,20April1969AlamatKantor:Kantor JurusanTeknik Kelautan,GedungWA,KampusITS,Surabayaatau,KantorDewanEnergiNasionalGedungBadiklatESDMlantai4
JI.Gatot Subroto,Kav. 49,Jakarta

AlamatRumah:PerumahanITS,JI.TeknikSipil,Blok X-14, Keputih, Surabaya60111

Namaistri:Ratri Handayani,S.Si.NamaAnak:1.AbduhMuhammadFatih2.Ahmad ShidqiMukhtasor3.AsmahanaMukhtasor4.Ahmad FaaiqMukhtasor

RiwayatPendidikan Formal/Akademis
1982:LulusSDN1,Margomulyo, Panggungrejo,Kab.Blitar1985:LulusSMPNSutojayan,Kab.Blitar1987:Lulus SMA PPSP IKIP(sekarangSMAN8)Malang1993:Sarjana, JurusanTeknikKimia, FakultasTeknologiIndustri,InstitutTeknologiSepuluhNopember(ITS)1998:MasterofEngineering,FacultyofEngineeringandAppliedScience,Memorial UniversityofNewfoundland,Canada2001:DoctorofPhilosophy,Memorial UniversityofNewfoundland,Canada.
32RiwayatPekerjaan
2009-2014 :AnggotaDewan EnergiNasionaldariStakeholderPakarLingkungan HidupdiBidang Energi.
20042006:Koordinator,International(Sandwich)MasterDegree ProgrammeinMarineandCoastalResourcesManagement,KerjasamaantaratheUniversityofNewcastle upon Tyne (UNT), Inggris,FakultasTeknologiKelautan ITS, danDepartemen Kelautan dan PerikananRI.
2004-2007:KoordinatorBidangLingkungandanEnergiLaut,FakultasTeknologiKelautan, ITS.
2003-2007 :Program Officer,SeaPartnershipProgram,RegionalCenterJawa Timur, DepartemenKelautandanPerikanan,RI.
2003-Sekarang: AnggotaPanelPakaruntuk ReviewerAMDALdiKantorMenteri Negara Lingkungan Hidup,RI.
2003-2006:Anggota PanelPakaruntukReviewerAMDALdiBadanPengendalian DampakLingkunganDaerah(BAPEDALDA),PropinsiJawa Timur.
2001-2008:Koordinator,ProgramPaskasa~anaJurusanTeknikKelautan,FTK-ITS.
2001-2006:Dosen ProgramPaskasa~anaTeknikLingkungan,FTSP-ITS.2001-Sekarang: Dosen/Promotor,ProgramPaskasarjanaTeknikKelautan,PPSTK,FTK-ITS.
2001-Sekarang: Anggota/Peneliti, PusatKependudukandanLingkungan Hidup, ITS.
1999:Assistant,MemorialUniversityofNewfoundland.
1994-Sekarang:Dosen Teknik Kelautan ITS.
33

.a ,,

Penghargaan
2008: DosenBerprestasiIII, ITS
2006:TandaKehormatan, SATYALANCANAKARYA SATYA,dari PresidenRepublik Indonesia.
2003:Pemenang,PenelitiProduktifITS2002,PusatPenelitianITS
2003: Canadian National Research Council (NRC)-fundedResearch:VisitingResearcherat theMemorial UniversityofNewfoundland,Canada
2002:InvitedSpeakerattheSecondWorldEngineeringCongress(WEC 2002),Kuching,Malaysia.
2001:FellowoftheSchoolofGraduate Studies,MemorialUniversityofNewfoundland,Canada.
2000:Award WinneratSocietyforRiskAnalysis 2000AnnualMeeting,Virginia,UnitedStatesofAmerica(USA).
1988: Mahasiswa BerprestasiITS

Riwayatpenelitian
2007-2008:PenelitiUtama,PenelitianHibahBersaing,”PercobaanSkalaLapanganBioremediasiTumpahanMinyak di Lingkungan Pantai dengan MetodeBiostimulasf’,Departemen PendidikanNasional,RI.
2005PenelitiUtama,”Pengembangan PendekatanEksperimenuntukPenelitianOceanOutfalls”,HibahPenelitian SegitigaBiru,FTK-ITS.2003-2004:PenelitiUtama,PenelitianHibahBersaing,”TeknologiOceanOutfall untuk DaerahWisataRenangWi/ayahPantai dengan Memadukan Hidrodinamika Efluen

342003

2002

2001

2001

1999

1998

1998-1999:

1996dan Resiko Kesehatan”,Departemen PendidikanNasional,RI.
VisitingResearcheratMemorialUniversity ofNewfoundland, Canada,underagrantfromtheCanadianNationalResearchCouncil (NRC).
PenelitiUtama,”PemodelanDifusiTurbulen untukSingle BuoyantJet”,ProyekDUE-LIKE,DirektoratJenderalPendidikanTinggi,Departemen PendidikanNasional,RI.
Hydrodynamics Modelingand EcologycalRiskAssessmentofProducedWaterDischargefromOilProductionPlatform,Ph.D.Desertation,MemorialUniversity of Newfoundland,Canada
PenelitiUtama,SensitivityAnalysisuntuk MixingZoneSingleBuoyant Jet dari VariabilitasdanKetidakpastian”,JapanSociety forPromotingScience(JSPS), PusatPenelitian,ITS.
ResearchEngineer,WaterQualityIndexDeterminationStudy,Memorial University ofNewfoundlandandWater Resources Division, WaterManagementandPlanning Section, Yellowknife,NT,Canada
ProbabilisticOceanOutfallDesign,M.EngThesis,Faculty of EngineeringandApplied Sciences,Memorial University of Newfoundland, Canada.
Research Engineer, MemorialUniversity ofNewfoundlandCanada.
PenelitiUtama,PemodelanDistribusiLimbah untukSuatuOceanOutfall,PusatPenelitian,ITS.

35

a PengalamanKegiatanLain

2010:Reviewer, ProgramPenelitian Insentif,Dewan RisetNasional-KementrianRisetdanTeknologi,RI.
2010-Sekarang:Ko-Promotor (eksternal),Program Paska Sarjana(S3),FakultasEkonomi,Universitas Airlangga.
2009:Reviewer, AnggotaPenilailTimPakar,AnalisisMengenaiDampakLingkungan (AMDAL),EvaluasiRencanaPengembangan TambangEmas, PT.NewmontNusaTenggaraBarat.
2008:Editor(Anggota),JurnalTeknologi,MAKARA,UniversitasIndonesia.
2007:Ketua TimStudi, Pemantauan PencemaranLaut,Kerjasama denganBadanKoordinasi KeamananLaut(BAKORKAMLA),RI.
2006:Reviewer,PenulisanBuku Teks, DP2M,DepartemenPendidikanNasional,RI.
2006-Sekarang,Pendiri dan Pembina Yayasan PengembanganSDMIPTEK, yang salah satu kegiatanpentingnyaadalahdesiminasi teknologidanpemberdayaanmasyarakatdalampemanfaat teknologienergibiogas dan limbahtemak/limbahorganik.(NotarisIyenSuhesti,SH., No.06/16April2007).
2006:Reviewer, AnggotaPeniiai/TimPakar,AnalisisMengenaiDampak Lingkungan (AMDAL), PembangunanPembangkitListrikTenagaUap/PLTU JawaTimuryang,BadanPengendalianDampak Lingkungan Daerah(BAPEDALDA)Propinsi JawaTimur.TigaProyekPLTU:Pacitan,Probolinggodan Tuban.2006:

2005:

2004:

2004:

2004:

2004:

2003:

2003:

2001:Ketua Tim Studi,PenyusunanActionPlatnPengendalianPencemaranLautPPIBrondong, Lamongan,Kerjasamadengan Dinas Perikanandan KelautanPropinsiJawaTimur.Ketua Tim Studi,PerencanaanKawasanKonservasiPantaiMadura,Kerjasama denganBadanPengendalianDampak Lingkungan (BAPEDAL), Propinsi JawaTimur.
TimAhli,StudiKelayakanHygienicFishMarketKenjeran,BadanPenelitiandanPengembangan, KotaSurabaya.
KetuaTimAhli,Studi Dampak Umbah DomestikkePanta;Kenjeran,BadanPenelitiandanPengembangan,KotaSurabaya.
AnggotaTim,Penyusunan Pedoman Umum Klaim GantiRugiTumpahan Minyak, Departemen KelautandanPerikanan,RI.
AnggotaTim Ahli,Analisis MengenaiDampak Lingkungan(AMDAL), TerminalTransitUtama Pertamina di Tuban,PusatKLH,LembagaPenelitiandanPengabdianMasyarakatITS,Surabaya.
Reviewer, AnggotaPeniiai/TimPakar,EnvironmentalImpactAssessment(AMDAL),DevelopmentofOilandGasField,Oyongdan MaleoFields,andConstruction ofUnderwaterPipelines attheMaduraStreat,KantorMenteri Negara Lingkungan Hidup,RI.
Ketua Tim Studi, PengembanganDecisionSupportSystemMiriyakTumpah diLaut,DepartemenKelautandanPerikanan,RepublikIndonesia.
Ketua Tim Studi, KonsepPengendalianPencemaranLaut,BadanPengendalianDampak Lingkungan (BAPEDAL),Propinsi Jawa Timur.

3637

.&4.Mukhtasor,AbdillahSuyuthi,DwiEndah Kusrini dan DanielBukuyangDiterbitkanM.Rosyid,2006,Studi PengembanganLingkunganPantai1.Husain,T.,Sadiq,R.Mukhtasor,Khan, A. A.2002.Kenjeran Sebagai KawasanEkowisataBahari,JurnalPesisirFramework forEcologicalRiskAssessment: Deterministicand&Lautan,Indonesian JournalofCoastal andMarineProbabilisticAnalyses,TheGulfEcosystem: HealthandResources(terakreditasi),PusatKajian Sumberdaya PesisirSustainability,EditedbyN.Y.Khan,M.MunawarandA.R.G.danLautanIPB,ISSN:1410-7821,7(1):27-41. Price,EcovisionMonograph Series, BackhuysPublisher, 5.MukhtasordanMaulidiyah, 2005,AnalisisResiko KesehatanLeiden, TheNetherlands,pp.377-396.danBiaya Pengolahan Limbah pada Evaluasi BakuMutuAir2.Mukhtasor, 2007,PencemaranPesisirdanLaut,PradnyaLautuntukBakteriEscherichiacoli(StudiKasus: DaerahPramita:Jakarta.Wisata Kepulauan SeribuJakarta),Jurnal TeknologiKelautan(terakreditasi),ISSN:1410-2919,9(2):92-98.3.Mukhtasordkk, 2008,PengantarIImu Lingkungan,ITS Press.
6.Mukhtasor2004, DiscussionofSensitivity Analysisand4.DanielM.Rosyid, 2008,RekayasaKeandalan,AirlanggaComparativePerformanceofOutfallswithSingleBuoyantPress,Mukhtasor(Editor).Plume,JournalofEnvironmental Engineering,ASCE,October2004.
7.Mukhtasor,TahirHusain, Brian Veitchand NeilBose2004,PublikasiJurnalAnEcologicalRiskMethodology forScreening Discharge1.Niu,H.,T.Husain,B.Veitch,andN.Bose,K.HawboldtandAltematives ofProduced Water,HumanandEcologicalRiskMukhtasor,2009,Assessing EcologicalRisksofProducedAssessment:AnInternationalJournal,HERA,ISSN100080WaterDischargeinaWavy Marine Environment,Advancesin7039,10(3):525-542Sustainable Petroleum EngineeringandScience.1(1).8.MukhtasordanHartoyo 2004, Metode Penentuan NilaiBaku2.MunawardanMukhtasor,2007, Pengujian NutrienAnorganikMutuPerairanpantaiuntukLogam Merkuri dan Kadmiumuntuk BioremediasiTumpahan MinyakMentahdenganBerbasisResikoKesehatandanBiaya,JurnalTeknologiMetodeBiostimulasidiLingkunganPantaiSurabayaTimur,Kelautan,8(1):23-32.JornalPurifikasi(terakreditasi),JurusanTeknikLingkungan9.Mukhtasor,Lye, L.M. andSharp J.J. 2002,ANew ApproachFTSP-ITS, ISSN:1411-3465,8(2):151-156.toInitial DilutionofBuoyancy-dominated JetinMoving Water,3.Munawar,Mukhtasordan TiniSurtiningsih,2007,JournalofEnvironmental Engineering andSCiences,1:101BioremediasiTumpahanMinyakMentahdenganMetode111.BiostimulasiNutrienOrganikdi Lingkungan Pantai Surabaya10.Mukhtasor,Lye,L.M. andSharp J.J. 2002, MethodsofBerkala Penelitian Hayati (JournalofBiologicalCompliance Evaluation forOceanOutfallDesignandResearches)(terakreditasi),PerhimpunanBiologiIndonesiaAnalysis,EnvironmentalManagement,30(4):536-546.Cabang Jawa Timur, ISSN:0852-6834,13(1):91-96.

3938

~11. Mukhtasor, Husain,T., Lye, L.M. andSharp J.J. 2002,HumanHealth Risk-based DesignofOceanOutfall,WaterandMaritime Engineering,ProceedingsoftheInstitutionofCivilEngineers,London,UK,154,issue#1:29-39.
12. Mukhtasor, SadiqR.,Husain,T.,Veitch,B.and Bose,N.2001,Acute EcologicalRiskAssociatedwithSoot Deposition:APersianGulfCaseStudy,OceanEngineering,Vol.28.No.9.pp.1295-1308.
13. Mukhtasor, Sharp, J.J.and Lye,L.M.1999a,UncertaintyAnalysisofOceanOutfalis,CanadianJournalofCivilEngineering,26:434-444.
14. Mukhtasor2002, UnjukKerjaTeknologi Ocean Outfall:MeneariAlternatifPenanganan LimbahdiLingkungan Pantai,JurnalTeknologi Kelautan,Vol.5.No.1,Januari, hal. 38-42.

PresentasidanProsidingSeminar
1. MauludiyahdanMukhtasor,2009, Perhitungan Skala BiayaKerugianakibatTumpahan Minyak: RelevansinyaPerairan Indonesia,Prosiding Seminar NasionalTeoridanAplikasiTeknologi Kelautan2009,ITS,ISSN:14122332,hal.A.119-A.128.
2. Zaman,B.,Mukhtasor,Sujantoko,2008, PemodelanPenyebaran Panas dari Buangan PembangkitListrikTenagaUap(PLTU)diPerairanPantai,ProsidingSeminarNasional,TeoridanAplikasiTeknologi Kelautan 2008: RekayasaEnergiuntukAplikasiTeknologi Kelautan,ITS, ISSN1412-2332,hal:0159-0168.
3. KartikaSudiati,MukhtasordanHasanIkhwani. 2007,ModelPencemaranyangBersumberdariOaratdi Pantai Kenjeran,ProsidingSeminar NasionalTeknik Sipil/11-2007,Program

40t,. Studi Pasca Sarjana Jurusan Teknik Sipil,ITS,ISBN:978979-99327-2-3,hal:E21-E34.
4. Mukhtasor, SujantokodanEstuP.Pribadi,2006,Pengembangan Teknik Percobaan Ocean Outfall untukLimbah Panasyangdilepas dari Anjungan MinyakLepasPantai,Prosiding SeminarTeoridanAplikasiTeknologiKelautanVI,Fakultas Teknologi Kelautan ITS, Surabaya,ISSN:1412-2332,hal:192-199.5. Bambang Suprakto, Wahyudi danMukhtasor,2006, StudiKondisi MangrovePesisirSelatan Kabupaten SampangMenggunakanDataLansatTM7,Prosiding Seminar NasionalKelautanII,UniversitasHangTuah, Surabaya,ISSN:9793153-21-0,hal:11.58-11.64.
6. Bambang Suprakto, WahyudidanMukhtasor,2006, KajianPenentuanKawasanKonservasi Mangrove BerdasarkanKriteriaBio-fisikLingkunganPesisirSelatan KabupatenSampang,ProsidingSeminar NasionalRekayasaPerencanaanVII,JurusanTeknilLingkungan,UniversitasPembangunanNasional”Veteran” Jatim, Surabaya,ISSN:979-98568-6-8,hal:0.5.1-0.5.9.
7. Mukhtasor, Totok AkbarSriyudianto,SuyadidanHaryoArmono, 2005, PemodelanOilSpillsdiPerairan Laut:Stud;KasusValidasiSoftware OILMAPW,ProsidingSeminarTeoridanApliokasiTekno/ogiKelautanV,Fakultas TeknologiKelautanITS,ISSN: 1412-2332, hal:111.98-111.104.
8. MunawardanMukhtasor,2005,ModelStoikiometriPerkiraan Jumlah Nutrien padaBioremediasiTumpahanMinyak denganMetodeBiostimulasidiLingkunganPantai,Prosiding SeminarTeori danApliokasiTeknologi KelautanV,Fakultas Teknologi KelautanITS, ISSN:1412-2332,hal:111.91-111.97.

41
.. 9.Mukhtasorand L.M. Lye2004,UseofResponse SurfaceMethodologyforExtractingAModelfromanArtificialNeuralFoundationDevelopmentsAdvanced Study InstituteonRecentinCoastalEutrophicationResearch:Network:ACaseof InitialDilution Modeling,ProceedingsofPrediction, DecisionSupportSystems,andManagement,The1stWaterand Environment SpecialtyConferenceoftheUniversityofHong Kong,5-12February.CanadianSocietyofCivilEngineering,CSCE,Saskatoon,16. Mukhtasor,Lye, L.M. andHusain,T.2001,FarFieldSascatchewan,Canada,WE.56.1-WE.56.11.Hydrodynamic ModelingofOcean Discharges: Methodsof
10. Mukhtasor,Setiawan,R.E.,Ikhwani,H.2003, SimulasiDealing withUncertainty,ConferenceofCanadianSocietyof
PenyebaranLimbah PanasuntukAnalisisPerancanganCivil Engineering(CSCE),June, Victoria.SistemSirkulasiAirPendingindiWilayah Pesisir,17. Mukhtasor, Husain,T.,Bose,N.andVeitch,B.2000,ProceedingsSeminar NasionalTeoridanAplikasiTeknologiProducedWaterDischargeinto the MarineEnvironment:Kelautan,FTK-ITS, Surabaya.Water QualityCriteriaandEnvironmentalRiskAssessment,
11. Mukhtasor2002, EvaluationOfBuoyantSpreadingProceedingsofThirdSpecialtyConferenceonEnvironmental
AssociatedDilutionsUnderUncertainty,ProceedingsoftheProgressinthe Petroleum&PetrochemicalIndustries,1-3ThirdRegionalMarineTechnologyConference, MARTECMay,Bahrain, paper#23.2002,10Juli, Surabaya,pp.49-59.18. Mukhtasor,Lye, L.M. andHusain,T.2000, Problemsof12. Mukhtasor, L.M.Lye andSharp, 2002, Mixing Zone AnalysisAsymptoticSolution-basedInitialDilution Modelsand NewofProducedWater DischargefromOffshoreOilProducingResearch Directions,Proceedingsofthe ConferenceofPlatform,Proceedings,2ndWorldEngineeringCongressCanadianSocietyofCivilEngineering(CSCE), London,ON.(WEC2002),Sepcial Volume,Civil&StructuralEngineering,19. MukhtasorandHusain,T.1999,EnvironmentalRiskKuching, Malaysia,pp.15-21.Assessmentand OceanOutfallDesign,Proceedingsofthe13. Mukhtasor2001,ApplicationofEnvironmentalRisk1999CanadianCoastalConference,19-22May,Victoria,BC,AssessmentMethodsforthe AnalysisofOcean Outfall,2:517-530.MarineTechnology2001,Achieving Global Competitiveness20. Mukhtasor,Lye, L.M. andHusain,T.1999,ProbabilisticInitialin theMarine Industry,UniversityTeknologi Malaysia, Johor.DilutionModelforOceanOutfalls,Proceedingsofthe14. Mukhtasor2000, Risk-based DesignofProducedWaterConferenceofCanadianSocietyofCivilEngineering(CSCE),Discharge from OffshoreOilProduction Platform,Applications2-5 June,Regina,2:139-147.ofRiskAnalysisinIndustry andGovernment,SocietyforRisk21. Mukhtasor,Sharp,J.J. and Lye, L.M.1998,Applicability ofAnalysis(SRA)AnnualMeeting,Crystal GatewayMarriott,First OrderSecond MomentandMonte CarloSimulationsinVirginia, December3-6.OceanOutfallDeSignandAnalysis,inProceedingsofthe1115. Mukhtasor, Husain,T.,Lye,L.M.andSharpJ.J. 2001,HumanthCongressoftheIAHR-APD,September8-10,Yogyakarta,Health Risk-based DesignofOcean Outfall,TheCroucherIndonesia,2:331-340.

42 4322.Mukhtasor,1998,ProbabilisticOceanOutfallDesign,M.Eng.
Thesis, MemorialUniversityofNewfoundland,pp.185.

23. Mukhtasor,2001,Hydrodynamic ModelingandEcological
Risk-basedDesignofProduced WaterDischargefrom an
OffshorePlatform,Ph.D.Thesis, MemorialUniversity of
Newfoundland,pp.244.

24. MukhtasorJ.J.SharpandL.M.Lye, 1997,Applicationof
ProbabitisticMethodsforInitialDilutionofHorizontalRound
JetinMoving Waters,ProceedingofISSM,2-3August1997,
Wiesbaden, Germany,115-117.

25. Sadiq,R.,Veitch,B.,Williams,C.,Pennell,V.,Niu,H.,
Worakanok,B.,Hawboldt,K.,Husain,T., Bose,N.,
Mukhtasor,Coles,C.2002,AnIntegrated Approachto
EnvironmentalDecision-MakingforOffshoreOiland Gas
Operations,Canada-BrazilOilandGasHSESeminar and
Workshop,March11-12March.

26. Sadiq,R.,Mukhtasor,Veitch,B.,Husain,T.,and Bose,N.
2000. Environmentalriskassessmentofwastesfromoffshore
oiloperations.Poster displayand abstract, Proceedings,
UnderstandingtheEnvironmental EffectsofOffshore
Hydrocarbon DevelopmentWorkshop,Sable Offshore Energy
Environmental Effects MonitoringAdvisoryGroup,Dartmouth.

27. MukhtasordanSatriyanto2002,ModifikasiPersamaanDifusi
TurbulenSatuDimensi sebagaiAlternatifTeknologi
PerencanaanOceanOutfall,ProceedingsSeminar Nasional,
InsentifEkonomidanTekno/ogida/amPembangunan
Berkelanjutan,Pusat Penelitian Kependudukandan
Lingkungan HidupITS,Surabaya,14 Mei,paper#B12.

44

Leave a Reply